Recombinant VSIV(strain 98COE North America) Matrix protein, His-Myc-tagged

• Cat.No.: Matrix-790V
• Product Overview: Recombinant VSIV(strain 98COE North America) Matrix protein(Q8B0I2)(1-229aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: VSIV(strain 98COE North America)
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-229aa
• Form: Tris-based buffer，50% glycerol
• Molecular Mass: 33.5 kDa
• AA Sequence: MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%.