Recombinant Staphylococcus Aureus ESXA Protein (1-97 aa), His-SUMO-tagged

• Cat.No.: ESXA-2064S
• Product Overview: Recombinant Staphylococcus Aureus (strain MSSA476) ESXA Protein (1-97 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Staphylococcus Aureus
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-97 aa
• Description: Virulence factor that is important for the establishment of infection in the host.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.0 kDa
• AA Sequence: MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: esxA
• UniProt ID: Q6GCJ0