Recombinant Sperm Whale Hemoglobin HBA&HBB Protein
Cat.No. : | HB-01W |
Product Overview : | Recombinant Sperm Whale Hemoglobin HBA&HBB Protein without tag was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Description : | Haemoglobin, the red pigment in blood, consists of a protein component and the iron complex of a porphyrin derivative: haemoglobin = globin (protein) + haemochromogen (Fe (II) complex). |
Source : | E. coli |
Species : | Whale |
Molecular Mass : | HBA: 16.2 kDa HBB: 18.2 kDa |
AA Sequence : | HBA: MVLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGKKVADALTKAVGHLDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPSVHASLDKFLASVSTVLTSKYRHHHHHH HBB: MVHLTGEEKSGLTALWAKVNVEEIGGEALGRLLVVYPWTQRFFEHFGDLSTADAVMKNPKVKKHGQKVLASFGEGLKHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKEFTPELQTAYQKVVAGVANALAHKYHWSHPQFEKHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Upon receipt, centrifuge the product briefly before opening the vial. Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 2.5 mg/mL (A280; Abs 0.1% (=1 g/L): 0.86) |
Storage Buffer : | Supplied in sterile PBS, pH7.4 |
Gene Name | LOC102987983 hemoglobin subunit alpha [ Physeter catodon (sperm whale) ] |
Official Symbol | LOC102987983 |
Synonyms | LOC102987983; hemoglobin subunit alpha; HBA; hemoglobin subunit alpha; LOC102976944; hemoglobin subunit beta-1/2; HBB; HB; hemoglobin subunit beta-1/2; hemoglobin subunit beta |
Gene ID | 102987983 |
mRNA Refseq | XM_007130378 |
Protein Refseq | XP_007130440 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HB Products
Required fields are marked with *
My Review for All HB Products
Required fields are marked with *
0
Inquiry Basket