Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged

• Cat.No.: TGFA-1538S
• Product Overview: Recombinant Sheep TGFA Protein (24-97 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Sheep
• Source: Yeast
• Tag: GST
• Protein Length: 24-97 aa
• Description: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.9 kDa
• AA Sequence: ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TGFA transforming growth factor alpha [ Ovis aries (sheep) ]
• Official Symbol: TGFA
• Synonyms: TGF-a
• Gene ID: 101106508
• UniProt ID: P98135