Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged

Cat.No. : TGFA-1538S
Product Overview : Recombinant Sheep TGFA Protein (24-97 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Sheep
Source : Yeast
Tag : GST
Protein Length : 24-97 aa
Description : TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.9 kDa
AA Sequence : ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name TGFA transforming growth factor alpha [ Ovis aries (sheep) ]
Official Symbol TGFA
Synonyms TGF-a;
Gene ID 101106508
UniProt ID P98135

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TGFA Products

Required fields are marked with *

My Review for All TGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon