Recombinant Sheep PRNP Protein, His-tagged
Cat.No. : | PRNP-652S |
Product Overview : | Recombinant Sheep PRNP(25-233 aa) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
ProteinLength : | 25-233 aa |
Form : | 10mM Tris HCl, pH 6.7 |
AA Sequence : | KKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGG GWGQPHGGGW GQPHGGGGWGQGGSHSQWNKPSKPKTNMKHVAGAAAAG AVVGGLGGYMLGSAMSRPLIHF GNDYEDRYYRENMYRYPNQVYYRPVD RYSNQNNFVHDCVNITVKQHTVTTTTKGENFTET DIKIMERVVEQMCI TQYQRESQAYYQRGA |
Purity : | > 95 % SDS-PAGE. |
Concentration : | Reconstitution Dependent |
Reconstitution : | Can be reconstituted in detergent-containing buffers e.g. TX-100 (0.5%) or under mild denaturing conditions (e.g. 1.5 M guanidine-HCl or urea). |
Gene Name | PRNP prion protein [ Ovis aries ] |
Official Symbol | PRNP |
Synonyms | PRNP; prion protein; major prion protein; prion protein (p27-30) (Creutzfeldt-Jakob disease, Gerstmann-Strausler-Scheinker syndrome, fatal familial insomnia); Prp; SIP; PRPC; |
Gene ID | 493887 |
mRNA Refseq | NM_001009481 |
Protein Refseq | NP_001009481 |
UniProt ID | P23907 |
◆ Recombinant Proteins | ||
BRD7-2836H | Recombinant Human BRD7 protein, His&FLAG-tagged | +Inquiry |
ATP5O-880R | Recombinant Rat ATP5O Protein | +Inquiry |
POP7-256H | Recombinant Human POP7, His-tagged | +Inquiry |
TNFRSF1A-203T | Active Recombinant Human TNFRSF1A Protein | +Inquiry |
KCNT1-3195H | Recombinant Human KCNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXM1-6152HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
WDR41-1927HCL | Recombinant Human WDR41 cell lysate | +Inquiry |
ARID3A-8727HCL | Recombinant Human ARID3A 293 Cell Lysate | +Inquiry |
Diencephalons-106R | Rhesus monkey Diencephalons Lysate | +Inquiry |
NAP1L1-3978HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
0
Inquiry Basket