Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged
Cat.No. : | IL4-1258S |
Product Overview : | Recombinant Sheep IL4 Protein (25-135aa) was expressed in E. coli with N-terminal His-B2M and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | B2M&His&Myc |
Protein Length : | 25-135 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLD RNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IL4 interleukin 4 [ Ovis aries (sheep) ] |
Official Symbol | IL4 |
Synonyms | IL4; IL-4; interleukin 4; B-cell stimulatory factor 1; BSF-1; lymphocyte stimulatory factor 1 |
Gene ID | 443327 |
mRNA Refseq | NM_001009313.2 |
Protein Refseq | NP_001009313.2 |
UniProt ID | P30368 |
◆ Recombinant Proteins | ||
IL4-203H | Recombinant Active Human IL4 Protein, His-tagged(C-ter) | +Inquiry |
IL4-5552C | Recombinant Cynomolgus monkey IL4 protein, His-tagged | +Inquiry |
IL4-017H | Recombinant Hamster IL4 Protein, Met1-Phe147, C-His tagged | +Inquiry |
Il4-245I | Active Recombinant Rat Il4 Protein, His-tagged | +Inquiry |
Il4-204M | Recombinant Active Mouse IL4 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket