Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged

• Cat.No.: IL4-1258S
• Product Overview: Recombinant Sheep IL4 Protein (25-135aa) was expressed in E. coli with N-terminal His-B2M and C-terminal MYC tag.

Specification

• Species: Sheep
• Source: E.coli
• Tag: His&Myc&B2M
• ProteinLength: 25-135 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 29.6 kDa
• AA Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLD
  RNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: IL4 interleukin 4 [ Ovis aries (sheep) ]
• Official Symbol: IL4
• Synonyms: IL4; IL-4; interleukin 4; B-cell stimulatory factor 1; BSF-1; lymphocyte stimulatory factor 1
• Gene ID: 443327
• mRNA Refseq: NM_001009313.2
• Protein Refseq: NP_001009313.2
• UniProt ID: P30368