Recombinant Salmo salar (Atlantic salmon) Vertebrate ancient opsin Transmembrane protein, His-SUMO-tagged
Cat.No. : | Vertebrate ancient opsin-295S |
Product Overview : | Recombinant Salmo salar (Atlantic salmon) Vertebrate ancient opsin protein(O13018)(1-75aa), fused with N-terminal His-SUMO tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmo salar (Atlantic salmon) |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-75aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.5kDa |
AA Sequence : | MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
OPSO-1400S | Recombinant S. salar Vertebrate ancient opsin Protein, His-B2M-tagged | +Inquiry |
Vertebrate ancient opsin-295S | Recombinant Salmo salar (Atlantic salmon) Vertebrate ancient opsin Transmembrane protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vertebrate ancient opsin Products
Required fields are marked with *
My Review for All Vertebrate ancient opsin Products
Required fields are marked with *
0
Inquiry Basket