Recombinant S. salar Vertebrate ancient opsin Protein, His-B2M-tagged

• Cat.No.: OPSO-1400S
• Product Overview: Recombinant Salmo salar Vertebrate ancient opsin Protein (1-75aa) was expressed in E. coli with N-terminal His-B2M tag.

Specification

• Species: S.salar
• Source: E.coli
• Tag: His&B2M
• ProteinLength: 1-75 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 22.5 kDa
• AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: LOC100136521 vertebrate ancient opsin [ Salmo salar (Atlantic salmon) ]
• Official Symbol: Vertebrate ancient opsin
• Synonyms: Vertebrate ancient opsin
• Gene ID: 100136521
• mRNA Refseq: NM_001123626.1
• Protein Refseq: NP_001117098.1
• UniProt ID: O13018