Recombinant Saccharomyces Cerevisiae AUR1 Protein (313-401 aa), His-B2M-Myc-tagged

• Cat.No.: AUR1-2405S
• Product Overview: Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) AUR1 Protein (313-401 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: S.cerevisiae
• Source: E.coli
• Tag: B2M&His&Myc
• Protein Length: 313-401 aa
• Description: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.7 kDa
• AA Sequence: TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: AUR1
• UniProt ID: P36107