Recombinant Rhesus SAA1 protein

• Cat.No.: SAA1-5197R
• Product Overview: Recombinant Rhesus SAA1 protein was expressed in Escherichia coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 104
• Description: Serum Amyloid A protein-1 belongs to the SAA family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). It is a multifunctional protein produced by hepatocytes in response to pro-inflammatory cytokines. SAA1 is a ligand for CD36/SR-B3, SR-B1, FPRL1, TLR2, and RAGE on monocytes/macrophages, inducing chemotaxis and generation of cytokines and tissue factor. It also can bind the surface of invading gram-negative bacteria, acting as an opsonin to aid clearance by macrophages. Additionally, SAA1 binds platelets, probably by engaging fibrinogen on the platelet surface.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
• AA Sequence: RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY
• Endotoxin: Less than 1 EU/μg of rRhSAA1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: SAA1
• Official Symbol: SAA1
• Synonyms: Amyloid fibril protein AA
• Gene ID: 694827
• mRNA Refseq: XM_015114692.2
• Protein Refseq: XP_014970178.2
• UniProt ID: F6V9N7