Recombinant Dog SAA1 Protein, His-GST-tagged

• Cat.No.: SAA1-1364D
• Product Overview: Recombinant Dog SAA1 Protein (19-129aa) was expressed in E. coli with N-terminal His-GST tag.

Specification

• Species: Dog
• Source: E.coli
• Tag: GST&His
• Protein Length: 19-129 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 42.5 kDa
• AA Sequence: QWYSFVSEAAQGAWDMWRAYSDMREANYKNSDKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRITDL
  LRFGDSGHGAEDSKADQAANEWGRSGKDPNHFRPAGLPDKY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: SAA1 serum amyloid A1 [ Canis lupus familiaris (dog) ]
• Official Symbol: SAA1
• Synonyms: SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein
• Gene ID: 751814
• mRNA Refseq: NM_001313872.1
• Protein Refseq: NP_001300801.1
• UniProt ID: P19708