Recombinant Rhesus monkey oncostatin M Protein

• Cat.No.: OSM-3255R
• Product Overview: Recombinant Rhesus monkey oncostatin M Protein without tag was expressed in Mammalian cell.

Specification

• Description: This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
• Source: Mammalian cell
• Species: Rhesus monkey
• Tag: Non
• Molecular Mass: ~ 26.6 kDa
• AA Sequence: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
• Endotoxin: < 1 EU/μg by LAL.
• Purity: ≥95 % by SDS-PAGE
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles.
• Storage Buffer: 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50 % glycerol
• Concentration: 0.7 mg/mL

Gene Information

• Gene Name: OSM oncostatin M [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: OSM
• Synonyms: OSM; oncostatin M; oncostatin-M
• Gene ID: 717994
• mRNA Refseq: NM_001194474
• Protein Refseq: NP_001181403
• UniProt ID: F7GF43