Recombinant Rhesus monkey IL2 Protein, His-SUMO/MYC-tagged

• Cat.No.: IL2-1256R
• Product Overview: Recombinant Rhesus monkey IL2 Protein (21-154aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: His&Myc&SUMO
• ProteinLength: 21-154 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 35.5 kDa
• AA Sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVL
  NLAQSKNFHLRDTKDLISNINVIVLELKGSETTLMCEYADETATIVEFLNRWITFCQSIISTLT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: IL2 interleukin 2 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IL2
• Synonyms: IL-2; interleukin 2; IL2
• Gene ID: 708017
• mRNA Refseq: NM_001047130.1
• Protein Refseq: NP_001040595.1
• UniProt ID: P68291