Recombinant Mouse Nus1 protein, His-tagged

• Cat.No.: Nus1-5632M
• Product Overview: Recombinant Mouse Nus1 protein(Q99LJ8)(140-297aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 140-297aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Gene Information

• Gene Name: Nus1 nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) [ Mus musculus ]
• Official Symbol: Nus1
• Synonyms: NUS1; nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae); nogo-B receptor; ngBR; AU019165; AW538011; BC003223; D10Ertd438e; MGC7199; 1600027K07Rik
• Gene ID: 52014
• mRNA Refseq: NM_030250
• Protein Refseq: NP_084526