Recombinant Human MECP2 protein, GST-tagged
Cat.No. : | MECP2-274H |
Product Overview : | Recombinant Human MECP2(C-term-350aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | C-term-350aa |
Description : | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
AA Sequence : | LIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRV LEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKA VKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPP KKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQ PAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ] |
Official Symbol | MECP2 |
Synonyms | MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; meCp-2 protein; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13; DKFZp686A24160; |
Gene ID | 4204 |
mRNA Refseq | NM_001110792 |
Protein Refseq | NP_001104262 |
MIM | 300005 |
UniProt ID | P51608 |
Chromosome Location | Xq28 |
Function | DNA binding; double-stranded methylated DNA binding; protein N-terminus binding; protein binding; protein domain specific binding; transcription corepressor activity; |
◆ Recombinant Proteins | ||
MECP2-682C | Recombinant Cynomolgus MECP2 Protein, His-tagged | +Inquiry |
MECP2-7946H | Recombinant Human MECP2 protein, His & T7-tagged | +Inquiry |
MECP2-12008Z | Recombinant Zebrafish MECP2 | +Inquiry |
MECP2-4530H | Recombinant Human MECP2 Protein (Met1-Ser486), C-His tagged | +Inquiry |
MECP2-2714R | Recombinant Rhesus monkey MECP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECP2-4395HCL | Recombinant Human MECP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MECP2 Products
Required fields are marked with *
My Review for All MECP2 Products
Required fields are marked with *
0
Inquiry Basket