Species : |
Rhesus macaque |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
121 |
Description : |
Interleukin-16 (IL-16) is also called lymphocyte chemoattractant factor (LCF) and it is mostly secreted by lymphocytes, epithelial cells, eosinophils, and CD8+ T cells. It has many functions including induction of the IL-2Rα on T cells, suppression of human immunodeficiency virus (HIV) replication, inhibition of T-cell antigen receptor/CD3 mediated T-cell stimulation in mixed lymphocyte reactions and so on. It signals through CD4 receptor. Furthermore, recombinant rhesus macaque interleukin-16 contains 121 amino acid residues and it shares 85 % ~ 95 % a.a. sequence identity with human and murine IL-16. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml. |
Molecular Mass : |
Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 121 amino acids. |
AA Sequence : |
SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS |
Endotoxin : |
Less than 1 EU/µg of rRhIL-16 as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |