Recombinant Mouse Il16 protein

• Cat.No.: Il16-548M
• Product Overview: Recombinant Mouse Il16 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 118
• Description: Interleukin-16 (IL-16) is also called lymphocyte chemoattractant factor (LCF) and it is mostly secreted by lymphocytes, epithelial cells, eosinophils, and CD8+ T cells. It has many functions including induction of the IL-2Rα on T cells, suppression of human immunodeficiency virus (HIV) replication, inhibition of T-cell antigen receptor/CD3 mediated T-cell stimulation in mixed lymphocyte reactions and so on. It signals through CD4 receptor. Furthermore, recombinant murine interleukin-16 contains 118 amino acid residues and it shares about 85 % a.a. sequence identity with different isoforms of human IL-16.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.
• Molecular Mass: Approximately 12.2 kDa, a single non-glycosylated polypeptide chain containing 118 amino acids.
• AA Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
• Endotoxin: Less than 1 EU/µg of rMuIL-16 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il16
• Official Symbol: Il16
• Synonyms: IL16; interleukin 16; pro-interleukin-16; mKIAA4048; KIAA4048
• Gene ID: 16170
• mRNA Refseq: NM_010551
• Protein Refseq: NP_034681
• UniProt ID: O54824