Recombinant Rhesus IL13 protein

• Cat.No.: IL13-542R
• Product Overview: Recombinant Rhesus IL13 protein was expressed in Escherichia coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 114
• Description: Interleukin-13 (IL-13) is expressed by the IL13 gene and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Mature rhesus IL-13 shares 94 %, 58 %, and 60 % amino acid sequence identity with human, mouse, and rat IL13, respectively.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 3% trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately12.6 kDa, a single non-glycosylated polypeptide chain containing 114 amino acids.
• AA Sequence: SPSPVPRSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGRFN
• Endotoxin: Less than 1 EU/μg of rRhIL-13 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL13
• Official Symbol: IL13
• Gene ID: 574325
• mRNA Refseq: NM_001032929.1
• Protein Refseq: NP_001028101.1
• UniProt ID: Q864V6