Recombinant Mouse Il13 Protein
Cat.No. : | Il13-089M |
Product Overview : | Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
Molecular Mass : | 11.7 kDa |
AA Sequence : | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Il13 interleukin 13 [ Mus musculus (house mouse) ] |
Official Symbol | Il13 |
Synonyms | Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600 |
Gene ID | 16163 |
mRNA Refseq | NM_008355 |
Protein Refseq | NP_032381 |
UniProt ID | P20109 |
◆ Recombinant Proteins | ||
IL13-328H | Active Recombinant Human IL13 | +Inquiry |
IL13-29107TH | Recombinant Human IL13 | +Inquiry |
Il13-580R | Recombinant Rat Il13 protein | +Inquiry |
IL13-505H | Recombinant Human IL13 Protein | +Inquiry |
IL13-854C | Recombinant Cattle IL13 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *
0
Inquiry Basket