Recombinant Rat VAMP2 Protein (2-94 aa), His-tagged

Cat.No. : VAMP2-2420R
Product Overview : Recombinant Rat VAMP2 Protein (2-94 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 2-94 aa
Description : Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.1 kDa
AA Sequence : SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Vamp2 vesicle-associated membrane protein 2 [ Rattus norvegicus ]
Official Symbol VAMP2
Synonyms VAMP2; vesicle-associated membrane protein 2; VAMP-2; synaptobrevin-2; SYB; Syb2; RATVAMPB; RATVAMPIR;
Gene ID 24803
mRNA Refseq NM_012663
Protein Refseq NP_036795
UniProt ID P63045

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VAMP2 Products

Required fields are marked with *

My Review for All VAMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon