Recombinant Human vesicle-associated membrane protein 2 (synaptobrevin 2) Protein, His tagged

• Cat.No.: VAMP2-22H
• Product Overview: Recombinant human VAMP2 protein, fused to His-tag at N-terminus, was expressed in E, coli and using conventional chromatography.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-94aa
• Description: The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG.
• Tag: N-His
• Form: Liquid
• Molecular Mass: 12.8 kDa
• AA Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 0.1mM PMSF
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• References: 1. Lin RC., et al. (1997) Neuron. 19(5):1087-94.
  2. Hanson PI., et al. (1997) Cell. 90(3):523-35.
  3. Scales SJ., et al. (2002) J Biol Chem. 277(31):28271-9.
  4. Windoffer R., et al. (1999) Cell Tissue Res. 296(3):499-510.

Gene Information

• Gene Name: VAMP2 vesicle-associated membrane protein 2 (synaptobrevin 2) [ Homo sapiens (human) ]
• Official Symbol: VAMP2
• Synonyms: VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460
• Gene ID: 6844
• mRNA Refseq: NM_014232
• Protein Refseq: NP_055047
• MIM: 185881
• UniProt ID: P63027