Recombinant Human VAMP2 protein, GST-tagged

• Cat.No.: VAMP2-218H
• Product Overview: Recombinant Human VAMP2 protein(NP_055047)(1-116 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 1-116 aa
• AA Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: VAMP2 vesicle-associated membrane protein 2 (synaptobrevin 2) [ Homo sapiens ]
• Official Symbol: VAMP2
• Synonyms: VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460
• Gene ID: 6844
• mRNA Refseq: NM_014232
• Protein Refseq: NP_055047
• MIM: 185881
• UniProt ID: P63027