Recombinant Rat TPC1808 protein, His-tagged

• Cat.No.: TPC1808-909R
• Product Overview: Recombinant Rat TPC1808 protein, fused to His-tag at the N-terminus, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 304
• Description: Tropic1808 is a candidate chemotropic factor induced by nerve injury. TPC1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. TPC1808 is the gene related to promotion of nerve growth, and both the TPC1808 gene and the TPC1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
• Molecular Mass: Approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 304 amino acids, with 6 x His at the N-terminus.
• AA Sequence: MSYYHHHHHHDYDIPTTENLYFQAMDPEFMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAPVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
• Endotoxin: Less than 1 EU/µg of rRtTPC1808, His as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TPC1808
• Official Symbol: TPC1808
• Synonyms: TPC1808 protein
• Gene ID: 64560
• mRNA Refseq: NM_022625.2
• Protein Refseq: NP_072147.1
• UniProt ID: Q9R0C2