Recombinant Rat Tpc1808, His-tagged

• Cat.No.: Tpc1808-660R
• Product Overview: Recombinant Rat Tpc1808 produced in E. coli is approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 275 amino acids, with 6 × His at N-terminu

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Description: Rat Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Molecular Mass: 29.1 kDa
• AA Sequence: MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAG VPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVT TPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTG APVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
• Endotoxin: Less than 1 EU/μg of rRtTPC 1808, His as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Usage: This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apport
• Reconstitution: We recommend that this vial be briefy centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion

Gene Information

• Gene Name: Tpc1808 tropic 1808 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Tpc1808
• Synonyms: Tpc1808;tropic 1808
• Gene ID: 64560
• mRNA Refseq: NM_022625.2
• Protein Refseq: NP_072147.1