Recombinant Rat Sost protein, hFc-tagged

Cat.No. : Sost-4567R
Product Overview : Recombinant Rat Sost protein(Q99P67)(29-213aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Mammalian Cells
Tag : Fc
Protein Length : 29-213aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50 kDa
AA Sequence : FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Sost sclerostin [ Rattus norvegicus ]
Official Symbol Sost
Synonyms SOST; sclerostin; sclerosteosis;
Gene ID 80722
mRNA Refseq NM_030584
Protein Refseq NP_085073

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Sost Products

Required fields are marked with *

My Review for All Sost Products

Required fields are marked with *

0

Inquiry Basket

cartIcon