Recombinant Rat SOST Protein (29-213 aa), His-Myc-tagged

• Cat.No.: SOST-2669R
• Product Overview: Recombinant Rat SOST Protein (29-213 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 29-213 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.0 kDa
• AA Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Sost sclerostin [ Rattus norvegicus ]
• Official Symbol: SOST
• Synonyms: SOST; sclerostin; sclerosteosis
• Gene ID: 80722
• mRNA Refseq: NM_030584
• Protein Refseq: NP_085073
• UniProt ID: Q99P67