Recombinant Rat RGN Protein (1-299 aa), His-tagged
Cat.No. : | RGN-1505R |
Product Overview : | Recombinant Rat RGN Protein (1-299 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-299 aa |
Description : | Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Rgn regucalcin (senescence marker protein-30) [ Rattus norvegicus ] |
Official Symbol | RGN |
Synonyms | RGN; regucalcin; SMP-30; gluconolactonase; Rc; GNL; Reguc; |
Gene ID | 25106 |
mRNA Refseq | NM_031546 |
Protein Refseq | NP_113734 |
UniProt ID | Q03336 |
◆ Recombinant Proteins | ||
RGN-5012R | Recombinant Rat RGN Protein | +Inquiry |
Rgn-3426R | Recombinant Rat Rgn protein, His-SUMO-tagged | +Inquiry |
RGN-4671R | Recombinant Rat RGN Protein, His (Fc)-Avi-tagged | +Inquiry |
RGN-11761Z | Recombinant Zebrafish RGN | +Inquiry |
RGN-30488TH | Recombinant Human RGN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGN-2388HCL | Recombinant Human RGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGN Products
Required fields are marked with *
My Review for All RGN Products
Required fields are marked with *
0
Inquiry Basket