Recombinant Rat Retn protein

• Cat.No.: Retn-1056R
• Product Overview: Recombinant Rat Retn protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 95
• Description: May contribute to impaired glucose tolerance and inhibition of adipocyte differentiation.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4, with 0.02 % Tween-20.
• Molecular Mass: Approximately 20.2 kDa, a disulfide-linked homodimer consisting of two 95 amino acid polypeptide chains.
• AA Sequence: MPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
• Endotoxin: Less than 0.1 EU/μg of rRtResistin as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Retn
• Official Symbol: Retn
• Synonyms: RETN; resistin
• Gene ID: 246250
• mRNA Refseq: NM_144741
• Protein Refseq: NP_653342
• UniProt ID: Q8K4J7