Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged

• Cat.No.: OSTN-1904R
• Product Overview: Recombinant Rat OSTN Protein (82-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 82-131 aa
• Description: Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.6 kDa
• AA Sequence: SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Ostn osteocrin [ Rattus norvegicus ]
• Official Symbol: OSTN
• Synonyms: OSTN; osteocrin; musclin
• Gene ID: 360730
• mRNA Refseq: NM_207612
• Protein Refseq: NP_997495
• UniProt ID: P61365