Recombinant Rat Ociad1 protein, His&Myc-tagged
Cat.No. : | Ociad1-5363R |
Product Overview : | Recombinant Rat Ociad1 protein(Q5XIG4)(1-247aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLIFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSLPPGHYTQKPKYDSNVSGQSSFGTSPAADNIEKETLPRYEPIPFSASMNESTPTGITDHIAQGPDPNLEDSPKRKSVTYEELRNKNRESYGVTLSHKTDPSVRPMQERGPQKEVKVNKYGDTWDE |
Gene Name | Ociad1 OCIA domain containing 1 [ Rattus norvegicus ] |
Official Symbol | Ociad1 |
Synonyms | OCIAD1; OCIA domain containing 1; OCIA domain-containing protein 1; ovarian carcinoma immunoreactive antigen; |
Gene ID | 289590 |
mRNA Refseq | NM_001013874 |
Protein Refseq | NP_001013896 |
◆ Recombinant Proteins | ||
OCIAD1-1571H | Recombinant Human OCIAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OCIAD1-1439H | Recombinant Human OCIAD1, GST-tagged | +Inquiry |
OCIAD1-11064M | Recombinant Mouse OCIAD1 Protein | +Inquiry |
OCIAD1-2035HFL | Recombinant Full Length Human OCIAD1 Protein, C-Flag-tagged | +Inquiry |
OCIAD1-5910H | Recombinant Human OCIAD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCIAD1-3606HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
OCIAD1-3605HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ociad1 Products
Required fields are marked with *
My Review for All Ociad1 Products
Required fields are marked with *
0
Inquiry Basket