Recombinant Human OCIAD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OCIAD1-5910H
• Product Overview: OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: OCIAD1 (OCIA Domain Containing 1) is a Protein Coding gene. Diseases associated with OCIAD1 include Ovarian Cancer and Ovarian Mucinous Neoplasm. An important paralog of this gene is OCIAD2.
• Molecular Mass: 21.4 kDa
• AA Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGRNFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OCIAD1 OCIA domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: OCIAD1
• Synonyms: OCIAD1; OCIA domain containing 1; OCIA domain-containing protein 1; Asrij; FLJ20455; OCIA; TPA018; ovarian carcinoma immunoreactive antigen; ASRIJ; MGC111072
• Gene ID: 54940
• mRNA Refseq: NM_001079842
• Protein Refseq: NP_001073311
• UniProt ID: Q9NX40