Recombinant Rat Ntf4 Protein, His-tagged

• Cat.No.: Ntf4-164R
• Product Overview: Recombinant Rat Ntf4 Protein(NP_037316.2)(Gly80~Ala209) is expressed from E. coli with a His Tag at the N-terminal.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• ProteinLength: Gly80~Ala209
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose.
• Molecular Mass: 18kDa(Analysis of differences refer to the manual)
• AA Sequence: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 95%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles.
  Store at 2-8°C for one month.
  Aliquot and store at -80°C for 12 months.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: Ntf4
• Official Symbol: Ntf4
• Synonyms: NT5; NTF4; NT-4/5; Neurotrophic Factor 4; Neurotrophin-5
• Gene ID: 25730
• mRNA Refseq: NM_013184.3
• Protein Refseq: NP_037316.2
• UniProt ID: P34131