Recombinant Human NTF4 protein

• Cat.No.: NTF4-16H
• Product Overview: Recombinant Human NTF4 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 131
• Description: NT-4 also named as NT-5 is a neuronal and epithelial grow factor belongs to the NGF-beta family. The NT-4 precursor is consisted of a 24 a.a. signal peptide, a 56 a.a. propertied and 130 a.a. NT-4. The mature protein has six Cys amino acid residues and has the relative structure with NT-3, BDNF (sharing about 48 % - 52 % sequence identity). Additionally, it shares 91 % and 95 % a.a. sequence identity with mouse and rat NT-4. NT-4 is mainly expressed in prostate and has low level thymus, placenta, and skeletal muscle. It can binding with the LNGFR and trkB receptors and plays a crucial role in the regulation of survival and the maintenance of peripheral sensory sympathetic neurons. Defect of NT-4 may cause primary open angle glaucoma type 1O.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 5.5.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg.
• Molecular Mass: Approximately 28.1 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (262 total amino acid residues).
• AA Sequence: MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
• Endotoxin: Less than 1 EU/μg of rHuNT-4 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: NTF4
• Official Symbol: NTF4
• Synonyms: NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5
• Gene ID: 4909
• mRNA Refseq: NM_006179
• Protein Refseq: NP_006170
• MIM: 162662
• UniProt ID: P34130