Recombinant Rat MMP12 Protein

• Cat.No.: MMP12-01R
• Product Overview: Recombinant Rat MMP12 Protein was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 102-465 a.a.
• Description: Predicted to enable several functions, including core promoter sequence-specific DNA binding activity; metal ion binding activity; and metalloendopeptidase activity. Involved in several processes, including positive regulation of epithelial cell proliferation; regulation of trophoblast cell migration; and response to hypoxia. Predicted to be located in cytoplasm; extracellular space; and nucleus. Used to study crescentic glomerulonephritis. Biomarker of anti-basement membrane glomerulonephritis and crescentic glomerulonephritis. Human ortholog(s) of this gene implicated in Barrett's esophagus; artery disease (multiple); coronary aneurysm; esophagus adenocarcinoma; and multiple sclerosis. Orthologous to human MMP12 (matrix metallopeptidase 12).
• Form: PBS, pH 7.4, 0.35 M Arginine, 10% Glycerol.
• Molecular Mass: 43 kDa
• AA Sequence: MRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKYWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLDRVTKTLSSTSWFGCLRHHHHHH
• Purity: > 90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.111mg/ml

Gene Information

• Gene Name: Mmp12 matrix metallopeptidase 12 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Mmp12
• Synonyms: ME; HME; MME; MMP-12
• Gene ID: 117033
• mRNA Refseq: NM_053963
• Protein Refseq: NP_446415
• UniProt ID: Q63341