Recombinant Rat Mif protein
Cat.No. : | Mif-488R |
Product Overview : | Recombinant Rat Mif protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 115 |
Description : | Macrophage migration inhibitory factor (MIF or MMIF), also named as glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, or phenylpyruvate tautomerase, is a protein encoded by the MIF gene. It is released from white blood cells by bacterial antigen stimulation to trigger an acute immune response, or by glucocorticoids to counter-act the inhibitory effects of glucocorticoids on immune system. MIF is a homotrimer of which each subunit contains 115 amino acids. As mentioned above, MIF is involved in the innate immune response to bacterial pathogens and counter-acts the anti-inflammatory activity of glucocorticoids. Furthermore, it also plays a role as mediator in regulating the function of macrophages in host defense and has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro. Rat MIF is 99%, 90%, 89%, and 89% a.a. identical to human, murine, porcine and bovine, respectively. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM Tris, pH 8.0, 150 mM NaCl, 3 % trehalose. |
Molecular Mass : | Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 115 amino acids. |
AA Sequence : | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
Endotoxin : | Less than 1 EU/µg of rRtMIF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Mif |
Official Symbol | Mif |
Synonyms | MIF, Glutathione-binding 13 kDa Protein, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase |
Gene ID | 81683 |
mRNA Refseq | NM_031051 |
Protein Refseq | NP_112313 |
UniProt ID | P30904 |
◆ Recombinant Proteins | ||
Mif-676R | Recombinant Rat Mif protein, His-tagged | +Inquiry |
MIF-2445H | Recombinant Human MIF Protein, His-tagged | +Inquiry |
Mif-71M | Recombinant Mouse Mif, His-tagged | +Inquiry |
MIF-3339R | Recombinant Rat MIF Protein, His (Fc)-Avi-tagged | +Inquiry |
MIF-3816H | Recombinant Human MIF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mif Products
Required fields are marked with *
My Review for All Mif Products
Required fields are marked with *
0
Inquiry Basket