Recombinant Rat Mif protein

• Cat.No.: Mif-488R
• Product Overview: Recombinant Rat Mif protein was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 115
• Description: Macrophage migration inhibitory factor (MIF or MMIF), also named as glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, or phenylpyruvate tautomerase, is a protein encoded by the MIF gene. It is released from white blood cells by bacterial antigen stimulation to trigger an acute immune response, or by glucocorticoids to counter-act the inhibitory effects of glucocorticoids on immune system. MIF is a homotrimer of which each subunit contains 115 amino acids. As mentioned above, MIF is involved in the innate immune response to bacterial pathogens and counter-acts the anti-inflammatory activity of glucocorticoids. Furthermore, it also plays a role as mediator in regulating the function of macrophages in host defense and has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro. Rat MIF is 99%, 90%, 89%, and 89% a.a. identical to human, murine, porcine and bovine, respectively.
• Form: Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM Tris, pH 8.0, 150 mM NaCl, 3 % trehalose.
• Molecular Mass: Approximately 12.5 kDa, a single non-glycosylated polypeptide chain containing 115 amino acids.
• AA Sequence: MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
• Endotoxin: Less than 1 EU/µg of rRtMIF as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Mif
• Official Symbol: Mif
• Synonyms: MIF, Glutathione-binding 13 kDa Protein, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase
• Gene ID: 81683
• mRNA Refseq: NM_031051
• Protein Refseq: NP_112313
• UniProt ID: P30904