Specification
Gene Information
Related Products
Download

Description :	Heparin-binding growth factor; involved in early fetal development of the rat adrenal.
Source :	E.coli
Species :	Rat
Form :	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
Bio-activity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml.
Molecular Mass :	Approximately 13.2 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids.
Protein length :	120
AA Sequence :	VAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD
Endotoxin :	Less than 0.1 EU/μg of rRtMidkine as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analyses.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non