Recombinant Rat LUM Protein (19-338 aa), His-tagged
Cat.No. : | LUM-1936R |
Product Overview : | Recombinant Rat LUM Protein (19-338 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Rat |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.5 kDa |
Protein length : | 19-338 aa |
AA Sequence : | QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lum lumican [ Rattus norvegicus ] |
Official Symbol | LUM |
Synonyms | LUM; lumican; KSPG lumican; keratan sulfate proteoglycan lumican; |
Gene ID | 81682 |
mRNA Refseq | NM_031050 |
Protein Refseq | NP_112312 |
UniProt ID | P51886 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LUM Products
Required fields are marked with *
My Review for All LUM Products
Required fields are marked with *
0
Inquiry Basket