Recombinant Rat LUM Protein (19-338 aa), His-tagged

Cat.No. : LUM-1936R
Product Overview : Recombinant Rat LUM Protein (19-338 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Rat
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.5 kDa
Protein length : 19-338 aa
AA Sequence : QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Lum lumican [ Rattus norvegicus ]
Official Symbol LUM
Synonyms LUM; lumican; KSPG lumican; keratan sulfate proteoglycan lumican;
Gene ID 81682
mRNA Refseq NM_031050
Protein Refseq NP_112312
UniProt ID P51886

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LUM Products

Required fields are marked with *

My Review for All LUM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon