Recombinant Rat LUM Protein (19-338 aa), His-tagged

• Cat.No.: LUM-1936R
• Product Overview: Recombinant Rat LUM Protein (19-338 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 19-338 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.5 kDa
• AA Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Lum lumican [ Rattus norvegicus ]
• Official Symbol: LUM
• Synonyms: LUM; lumican; KSPG lumican; keratan sulfate proteoglycan lumican
• Gene ID: 81682
• mRNA Refseq: NM_031050
• Protein Refseq: NP_112312
• UniProt ID: P51886