Recombinant Full Length Human LUM Protein
Cat.No. : | LUM-290HF |
Product Overview : | Recombinant full length Human Lumican with a N terminal proprietary tag: Predicted molecular weight 63.25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 338 amino acids |
Description : | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. |
Form : | Liquid |
Molecular Mass : | 63.250kDa inclusive of tags |
AA Sequence : | MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPE CNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDH IDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVN LTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETS LPPDMYECLRVANEVTLN |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | LUM lumican [ Homo sapiens ] |
Official Symbol | LUM |
Synonyms | LUM; lumican; LDC; lumican proteoglycan; SLRR2D |
Gene ID | 4060 |
mRNA Refseq | NM_002345 |
Protein Refseq | NP_002336 |
MIM | 600616 |
UniProt ID | P51884 |
◆ Recombinant Proteins | ||
LUM-154H | Recombinant Human LUM protein, His-tagged | +Inquiry |
Lum-5035R | Recombinant Rat Lum protein, His-tagged | +Inquiry |
LUM-9360M | Recombinant Mouse LUM Protein | +Inquiry |
LUM-3223H | Recombinant Human LUM, His tagged | +Inquiry |
LUM-3504R | Recombinant Rat LUM Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUM-2210HCL | Recombinant Human LUM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LUM Products
Required fields are marked with *
My Review for All LUM Products
Required fields are marked with *
0
Inquiry Basket