Recombinant Rat Lgals4 protein
Cat.No. : | Lgals4-3168R |
Product Overview : | Recombinant Rat Lgals4 protein(P38552)(1-324aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-324aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lgals4 lectin, galactoside-binding, soluble, 4 [ Rattus norvegicus ] |
Official Symbol | Lgals4 |
Synonyms | LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; gal-4; L36LBP; lactose-binding lectin 4; L-36 lactose-binding protein; Lectin galactose binding soluble 4 (Galectin-4); Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside-binding, soluble, 4 (galectin 4); L-36; L36LBI; |
Gene ID | 25474 |
mRNA Refseq | NM_012975 |
Protein Refseq | NP_037107 |
◆ Recombinant Proteins | ||
LGALS4-2053M | Recombinant Mouse LGALS4 Protein (1-326 aa), His-tagged | +Inquiry |
LGALS4-323H | Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
LGALS4-4439H | Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
LGALS4-528H | Recombinant Human LGALS4 Protein, MYC/DDK-tagged | +Inquiry |
LGALS4-1802H | Recombinant Human Lectin, Galactoside-binding, Soluble, 4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lgals4 Products
Required fields are marked with *
My Review for All Lgals4 Products
Required fields are marked with *
0
Inquiry Basket