Recombinant Rat Lgals4 protein

• Cat.No.: Lgals4-3168R
• Product Overview: Recombinant Rat Lgals4 protein(P38552)(1-324aa) was expressed in E. coli.

Specification

• Source: E. coli
• Species: Rat
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.3 kDa
• Protein length: 1-324aa
• AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Lgals4 lectin, galactoside-binding, soluble, 4 [ Rattus norvegicus ]
• Official Symbol: Lgals4
• Synonyms: LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; gal-4; L36LBP; lactose-binding lectin 4; L-36 lactose-binding protein; Lectin galactose binding soluble 4 (Galectin-4); Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside-binding, soluble, 4 (galectin 4); L-36; L36LBI
• Gene ID: 25474
• mRNA Refseq: NM_012975
• Protein Refseq: NP_037107