Recombinant Rat Lgals3 protein, His-tagged

• Cat.No.: Lgals3-3166R
• Product Overview: Recombinant Rat Lgals3 protein(P08699)(2-262aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Rat
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.1 kDa
• Protein length: 2-262aa
• AA Sequence: ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Lgals3 lectin, galactoside-binding, soluble, 3 [ Rattus norvegicus ]
• Official Symbol: Lgals3
• Synonyms: LGALS3; lectin, galactoside-binding, soluble, 3; galectin-3; CBP 35; lectin L-29; 35 kDa lectin; mac-2 antigen; IgE binding protein; igE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; lectin, galactose binding, soluble 3; gal-3; MGC105387
• Gene ID: 83781
• mRNA Refseq: NM_031832
• Protein Refseq: NP_114020