Recombinant Human LGALS3 Protein, His-tagged
Cat.No. : | LGALS3-261H |
Product Overview : | Recombinant human LGALS3 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 250 |
Description : | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. |
Form : | Lyophilized |
Molecular Mass : | 27.5 kDa |
AA Sequence : | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens (human) ] |
Official Symbol | LGALS3 |
Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP; |
Gene ID | 3958 |
mRNA Refseq | NM_001177388 |
Protein Refseq | NP_001170859 |
MIM | 153619 |
UniProt ID | P17931 |
◆ Recombinant Proteins | ||
Lgals3-343R | Recombinant Rat Lgals3 protein, His-tagged | +Inquiry |
Lgals3-7258M | Active Recombinant Mouse Lgals3 Protein, His-tagged | +Inquiry |
LGALS3-12H | Recombinant Human LGALS3, MYC/DDK-tagged | +Inquiry |
LGALS3-1089H | Recombinant Human LGALS3 Protein, His-tagged | +Inquiry |
LGALS3-3387R | Recombinant Rat LGALS3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS3 Products
Required fields are marked with *
My Review for All LGALS3 Products
Required fields are marked with *
0
Inquiry Basket