Recombinant Rat Il5 protein

• Cat.No.: Il5-2095R
• Product Overview: Recombinant Rat Il5 protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 113
• Description: IL-5, also named B-cell differentiation factor I, eosinophil differentiation factor and TRF, is belonging to the cytokine family and the IL-5 gene is in close proximity to the genes encoding IL-3, IL-4, and granulocyte-macrophage colony-stimulating factor (GM-CSF), which are often co-expressed in TH2 cells. Through binding to the IL-5 receptor, IL-5 stimulates B cell growth and increases immunroglobulin secretion. It is also a key mediator in eosinophil activation. Interleukin-5 has long been associated with the cause of several allergic diseases including allergic rhinitis and asthma.Rat IL-5 is a 132-amino acid (115 in human, 133 in the mouse) -long TH2 cytokine that is part of the hematopoietic family. Unlike other members of this cytokine family (namely IL-3 and GM-CSF), this glycoprotein in its active form is a homodimer.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 26.2 kDa, a disulfide-linked homodimeric protein containing two 113 amino acids.
• AA Sequence: MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
• Endotoxin: Less than 1 EU/μg of rRtIL-5 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il5
• Official Symbol: Il5
• Synonyms: B-cell Differentiation Factor I, Eosinophil Differentiation Factor, TRF
• Gene ID: 24497
• mRNA Refseq: NM_021834
• Protein Refseq: NP_068606
• UniProt ID: Q08125