Recombinant Rat HSD17B10 Protein (2-261 aa), His-tagged
| Cat.No. : | HSD17B10-2273R |
| Product Overview : | Recombinant Rat HSD17B10 Protein (2-261 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. |
| Source : | Yeast |
| Species : | Rat |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 29.1 kDa |
| Protein length : | 2-261 aa |
| AA Sequence : | AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Hsd17b10 hydroxysteroid (17-beta) dehydrogenase 10 [ Rattus norvegicus ] |
| Official Symbol | HSD17B10 |
| Synonyms | HSD17B10; type II HADH; 17-beta-HSD 10; Hadh2; |
| Gene ID | 63864 |
| mRNA Refseq | NM_031682 |
| Protein Refseq | NP_113870 |
| UniProt ID | O70351 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B10 Products
Required fields are marked with *
My Review for All HSD17B10 Products
Required fields are marked with *
0
Inquiry Basket
