Recombinant Human HSD17B10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HSD17B10-4780H
• Product Overview: HSD17B10 MS Standard C13 and N15-labeled recombinant protein (NP_004484) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids and steroids, and is a subunit of mitochondrial ribonuclease P, which is involved in tRNA maturation. The protein has been implicated in the development of Alzheimer disease, and mutations in the gene are the cause of 17beta-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Molecular Mass: 26.9 kDa
• AA Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HSD17B10 hydroxysteroid 17-beta dehydrogenase 10 [ Homo sapiens (human) ]
• Official Symbol: HSD17B10
• Synonyms: HSD17B10; hydroxysteroid (17-beta) dehydrogenase 10; HADH2, hydroxyacyl Coenzyme A dehydrogenase, type II, hydroxyacyl Coenzyme A dehydrogenase, type II, mental retardation, X linked, syndromic 10, MRXS10; 3-hydroxyacyl-CoA dehydrogenase type-2; 17b HSD10; AB binding alcohol dehydrogenase; ABAD; CAMR; ERAB; MHBD; MRPP2; SDR5C1; short chain dehydrogenase/reductase family 5C; member 1; type 10 17b HSD; type 10 17beta hydroxysteroid dehydrogenase; AB-binding alcohol dehydrogenase; mitochondrial ribonuclease P protein 2; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; short chain type dehydrogenase/reductase XH98G2; amyloid-beta peptide binding alcohol dehydrogenase; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain dehydrogenase/reductase family 5C, member 1; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; HCD2; HADH2; MRX17; MRX31; SCHAD; MRXS10; 17b-HSD10; DUPXp11.22
• Gene ID: 3028
• mRNA Refseq: NM_004493
• Protein Refseq: NP_004484
• MIM: 300256
• UniProt ID: Q99714