Recombinant Rat Hmgb1 protein, His-tagged
Cat.No. : | Hmgb1-3037R |
Product Overview : | Recombinant Rat Hmgb1 protein(P63159)(2-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-215aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
AA Sequence : | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hmgb1 high mobility group box 1 [ Rattus norvegicus ] |
Official Symbol | Hmgb1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group protein B1; HMG-1; amphoterin; high mobility group 1; heparin-binding protein p30; high mobility group protein 1; Hmg1; Ac2-008; MGC93598; MGC93599; |
Gene ID | 25459 |
mRNA Refseq | NM_012963 |
Protein Refseq | NP_037095 |
◆ Recombinant Proteins | ||
Hmgb1-2628M | Active Recombinant Mouse Hmgb1 protein, His-tagged | +Inquiry |
HMGB1-559H | Recombinant Human HMGB1 protein, His-tagged | +Inquiry |
HMGB1-8460H | Active Recombinant Human HMGB1, His-tagged | +Inquiry |
Hmgb1-6948M | Active Recombinant Mouse Hmgb1 protein(Met1-Glu215), hFc-tagged | +Inquiry |
Hmgb1-293R | Recombinant Rat Hmgb1, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hmgb1 Products
Required fields are marked with *
My Review for All Hmgb1 Products
Required fields are marked with *
0
Inquiry Basket