Recombinant Rat Hmgb1 protein, His-tagged

• Cat.No.: Hmgb1-3037R
• Product Overview: Recombinant Rat Hmgb1 protein(P63159)(2-215aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 2-215aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.8 kDa
• AA Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Hmgb1 high mobility group box 1 [ Rattus norvegicus ]
• Official Symbol: Hmgb1
• Synonyms: HMGB1; high mobility group box 1; high mobility group protein B1; HMG-1; amphoterin; high mobility group 1; heparin-binding protein p30; high mobility group protein 1; Hmg1; Ac2-008; MGC93598; MGC93599
• Gene ID: 25459
• mRNA Refseq: NM_012963
• Protein Refseq: NP_037095