Recombinant Rat Hmgb1 protein, His-tagged

Cat.No. : Hmgb1-3037R
Product Overview : Recombinant Rat Hmgb1 protein(P63159)(2-215aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Product Overview : Recombinant Rat Hmgb1 protein(P63159)(2-215aa), fused to N-terminal His tag, was expressed in E. coli.
Source : E. coli
Species : Rat
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.8 kDa
Protein length : 2-215aa
AA Sequence : GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Hmgb1 high mobility group box 1 [ Rattus norvegicus ]
Official Symbol Hmgb1
Synonyms HMGB1; high mobility group box 1; high mobility group protein B1; HMG-1; amphoterin; high mobility group 1; heparin-binding protein p30; high mobility group protein 1; Hmg1; Ac2-008; MGC93598; MGC93599;
Gene ID 25459
mRNA Refseq NM_012963
Protein Refseq NP_037095

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Hmgb1 Products

Required fields are marked with *

My Review for All Hmgb1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon