Recombinant Rat Fxn protein

• Cat.No.: Fxn-2934R
• Product Overview: Recombinant Rat Fxn protein(D3ZYW7)(41-208aa) was expressed in E. coli.

Specification

• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.6 kDa
• Protein length: 41-208aa
• AA Sequence: LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Fxn frataxin [ Rattus norvegicus ]
• Official Symbol: Fxn
• Synonyms: FXN; frataxin; frataxin, mitochondrial; RGD1565754
• Gene ID: 499335
• mRNA Refseq: NM_001191952
• Protein Refseq: NP_001178881