Recombinant Rat Fgf9 protein

• Cat.No.: Fgf9-112R
• Product Overview: Recombinant Rat Fgf9 protein was expressed in Escherichia coli.

Specification

• Description: Fibroblast growth factor-9 (FGF-9) is a member of the fibroblast growth factor (FGF) family. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. The rat FGF-9 shares 98 % a.a. sequence identity with human FGF-9.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 400 mM NaCl, pH 8.0.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 23.1 kDa, a single non-glycosylated polypeptide chain containing 205 amino acids.
• Protein length: 205
• AA Sequence: LGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: Less than 1 EU/µg of rRtFGF-9-1 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Fgf9
• Official Symbol: Fgf9
• Synonyms: GAF, Glia-activating factor, HBGF-9
• Gene ID: 25444
• mRNA Refseq: NM_012952
• Protein Refseq: NP_037084
• UniProt ID: P36364