Recombinant Rat Fgf9 protein
Cat.No. : | Fgf9-112R |
Product Overview : | Recombinant Rat Fgf9 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 205 |
Description : | Fibroblast growth factor-9 (FGF-9) is a member of the fibroblast growth factor (FGF) family. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. The rat FGF-9 shares 98 % a.a. sequence identity with human FGF-9. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 400 mM NaCl, pH 8.0. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 23.1 kDa, a single non-glycosylated polypeptide chain containing 205 amino acids. |
AA Sequence : | LGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | Less than 1 EU/µg of rRtFGF-9-1 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Fgf9 |
Official Symbol | Fgf9 |
Synonyms | GAF, Glia-activating factor, HBGF-9 |
Gene ID | 25444 |
mRNA Refseq | NM_012952 |
Protein Refseq | NP_037084 |
UniProt ID | P36364 |
◆ Recombinant Proteins | ||
FGF9-406F | Active Recombinant Human FGF9 Protein (208 aa) | +Inquiry |
FGF9-170C | Active Recombinant Canine FGF9 protein, mFc-tagged | +Inquiry |
FGF9-94H | Active Recombinant Human FGF9 Protein | +Inquiry |
FGF9-4117H | Recombinant Human FGF9 Protein, GST-tagged | +Inquiry |
FGF9-16H | Recombinant Human FGF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf9 Products
Required fields are marked with *
My Review for All Fgf9 Products
Required fields are marked with *
0
Inquiry Basket