Active Recombinant Human FGF9 Protein (208 aa)

• Cat.No.: FGF9-406F
• Product Overview: Recombinant Human Fibroblast Growth Factor-9(rhFGF-9) produced in E. coli is a single non-glycosylated polypeptide chain containing 208 amino acids. A fully biologically active molecule, rhFGF-9 has a molecular mass of 23.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Description: Fibroblast Growth Factor-9 (FGF-9) is a heparin binding growth factor that belongs to the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-9 was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2.0 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of >5.0 × 10^5 units/mg.
• Molecular Mass: 23.4 kDa, observed by reducing SDS-PAGE.
• Protein length: 208
• AA Sequence: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant Human Fibroblast Growth Factor-9(rhFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-9 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ]
• Official Symbol: FGF9
• Synonyms: FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915
• Gene ID: 2254
• mRNA Refseq: NM_002010
• Protein Refseq: NP_002001
• MIM: 600921
• UniProt ID: P31371