Recombinant Rat Fgf21 protein
Cat.No. : | Fgf21-589R |
Product Overview : | Recombinant Rat Fgf21 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 180 |
Description : | Fibroblast growth factor 21 (FGF-21) encoded by the FGF-21 gene belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF-21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) and the activity depends on the presence of KLB. Recombinant rat FGF-21 contains 180 amino acids residues and show limited binding to heparin. In addition, rat FGF-21 respectively shows 81 % and 92 % a.a. identity to human and murine FGF-21, and it show activity on murine and human cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, 500 mM NaCl, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 × 10³ IU/mg in the presence of 5 µg/ml of rMuKlotho-β and 10 μg/ml of heparin. |
Molecular Mass : | Approximately 19.7 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids. |
AA Sequence : | AYPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELLLKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPGVLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
Endotoxin : | Less than 1 EU/µg of rRtFGF-21 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Fgf21 |
Official Symbol | Fgf21 |
Synonyms | FGF21; fibroblast growth factor 21; |
Gene ID | 170580 |
mRNA Refseq | NM_130752 |
Protein Refseq | NP_570108 |
UniProt ID | Q8VI80 |
◆ Recombinant Proteins | ||
FGF21-1236C | Recombinant Cynomolgus FGF21 Protein, His-tagged | +Inquiry |
FGF21-104H | Recombinant Human FGF21, His-tagged | +Inquiry |
FGF21-103H | Recombinant Human Fibroblast Growth Factor 21 | +Inquiry |
ADD2-9414H | Recombinant Human ADD2 protein, His-tagged | +Inquiry |
Fgf21-257M | Active Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf21 Products
Required fields are marked with *
My Review for All Fgf21 Products
Required fields are marked with *
0
Inquiry Basket