Recombinant Rat EFNA5 Protein (21-203 aa), His-tagged
Cat.No. : | EFNA5-470R |
Product Overview : | Recombinant Rat EFNA5 Protein (21-203 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-203 aa |
Description : | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like mbrane microdomain when bound to the Extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 25.2 kDa |
AA Sequence : | QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Efna5 ephrin A5 [ Rattus norvegicus ] |
Official Symbol | EFNA5 |
Synonyms | EFNA5; ephrin A5; ephrin-A5; AL-1; LERK-7; Lerk7; |
Gene ID | 116683 |
mRNA Refseq | NM_053903 |
Protein Refseq | NP_446355 |
UniProt ID | P97605 |
◆ Recombinant Proteins | ||
EFNA5-1133H | Recombinant Human EFNA5 protein, His & T7-tagged | +Inquiry |
EFNA5-700H | Active Recombinant Human EFNA5, His tagged | +Inquiry |
EFNA5-16H | Recombinant Human EFNA5 Protein, hIgG/His-tagged | +Inquiry |
EFNA5-130R | Active Recombinant Rhesus EFNA5 protein, hFc-tagged | +Inquiry |
Efna5-5393R | Recombinant Rat Efna5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA5-2156MCL | Recombinant Mouse EFNA5 cell lysate | +Inquiry |
EFNA5-993CCL | Recombinant Canine EFNA5 cell lysate | +Inquiry |
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
EFNA5-1430CCL | Recombinant Cynomolgus EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA5 Products
Required fields are marked with *
My Review for All EFNA5 Products
Required fields are marked with *
0
Inquiry Basket